LL-37

Chemical & Product Specifications

• Compound Name: Cathelicidin LL-37 (Ropocamptide)

• Sequence: Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser

• One-Letter Sequence: LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

• CAS Number: 154947-66-7

• Molecular Formula: $text{C}_{205}text{H}_{340}text{N}_{60}text{O}_{53}$

• Theoretical Molecular Mass: 4493.3 Da

• Physical Form: White lyophilized solid / cake

Batch & Analytical Profile

• Available Vial Quantities: 2 mg per vial | 5 mg per vial

• Lot / Batch Numbers:

  • 2 mg Vial: PL-2609-066

  • 5 mg Vial: PL-2609-067

• Purity (RP-HPLC): $ge 99.0%$

• Identity (LC-MS): Monoisotopic mass confirmed within theoretical specification $pm 1.0text{ Da}$

• Container: Type I borosilicate glass serum vial fitted with a chlorobutyl elastomer stopper and a tamper-evident flip-off aluminum crimp seal

Storage & Handling Parameters

• Lyophilized Form: Store at $-20^circtext{C}$ in an airtight, desiccated, and light-protected laboratory freezer.

For Research Use Only (RUO). Not for human or veterinary use.

For Research Use Only (RUO). Not for human or veterinary use.