AT-SRM

AT-SRM Chemical & Product Specifications

• 
  Display Name: AT-SRM
  

• Material Identity: Sermorelin Acetate

• Compound Name: Sermorelin Acetate (GHRH (1–29) Amide Acetate Salt)

• Sequence:
  H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH₂ · CH₃COOH

• One-Letter Sequence:
  YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH₂

• 
  CAS Number:
  114466-38-5 (Acetate salt) | 86168-78-7 (Free base)
  

• 
  Molecular Formula:
  C₁₅₁H₂₅₀N₄₄O₄₄S (Acetate form; Free base: C₁₄₉H₂₄₆N₄₄O₄₂S)
  

• 
  Theoretical Molecular Mass:
  Approximately 3417.9 Da (Acetate salt; Free base: 3357.9 Da)
  

• Physical Form:
  White lyophilized solid / cake

Batch & Analytical Profile

• Available Vial Quantities:
  2 mg per vial | 5 mg per vial

• Lot / Batch Numbers:

  • 2 mg Vial:
    PL-2609-096

  • 5 mg Vial:
    PL-2609-097

• Purity (RP-HPLC):
  ≥ 99.0%

• Identity (LC-MS, ESI+):
  Observed monoisotopic mass confirmed within theoretical specification ± 1.0 Da

• Container:
  Type I borosilicate glass serum vial fitted with a chlorobutyl elastomer stopper and a tamper-evident flip-off aluminum crimp seal

Storage & Handling Parameters

• 
  Lyophilized Form:
  Store at -20°C in an airtight, desiccated, and light-protected laboratory freezer.
  
  
  Protect from atmospheric moisture.
  

For Research Use Only (RUO). Not for human or veterinary use.